PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C000615P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family Trihelix
Protein Properties Length: 131aa    MW: 13506.9 Da    PI: 4.3109
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C000615P1genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix36.31.5e-1195130136
        trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevsk 36 
                     rW++qe+laL+++r+em++ +r++ lk+plW+evs+
  MELO3C000615P1  95 RWPRQETLALLKIRSEMDSVFRDATLKGPLWDEVSR 130
                     8*********************************96 PP

Sequence ? help Back to Top
Protein Sequence    Length: 131 aa     Download sequence    Send to blast
MEPPAPGSGL PDPSQLFRVV STPPPPPSLT VDTTISDSQQ VEAASPISSR PPAVPSSYEE  60
LIRLGGGGGA GHMVVDDDEA DGRSGGGSGG SGGNRWPRQE TLALLKIRSE MDSVFRDATL  120
KGPLWDEVSR *
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6870160.0LN687016.1 Cucumis melo genomic scaffold, unassembled_sequence34520.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011654662.19e-59PREDICTED: trihelix transcription factor GTL1 isoform X1
RefseqXP_011654663.13e-59PREDICTED: trihelix transcription factor GTL1 isoform X2
SwissprotQ9C8822e-18GTL1_ARATH; Trihelix transcription factor GTL1
TrEMBLB9I0M99e-27B9I0M9_POPTR; Uncharacterized protein
STRINGPOPTR_0011s15050.13e-26(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF2103344
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G33240.13e-20GT-2-like 1